Kisspeptin (KISS1) (NM_002256) Human Mass Spec Standard

CAT#: PH306859

KISS1 MS Standard C13 and N15-labeled recombinant protein (NP_002247)

Product Images

Coomassie blue staining of purified KISS1 protein (Cat# TP306859). The protein was produced from HEK293T cells transfected with KISS1 cDNA clone (Cat# RC206859) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206859
• Predicted MW: 14.7 kDa
• Protein Sequence:
  Sequence Link

  >RC206859 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTS
  LSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002247
• RefSeq Size: 731
• RefSeq ORF: 414
• Synonyms: HH13; KiSS-1
• Locus ID: 3814
• UniProt ID: Q15726
• Cytogenetics: 1q32.1
• Summary: 'This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Studies suggest a putative role in the regulation of events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. A protein product of this gene, kisspeptin, stimulates gonadotropin-releasing hormone (GnRH)-induced gonadotropin secretion and regulates the pubertal activation of GnRH nuerons. A polymorphism in the terminal exon of this mRNA results in two protein isoforms. An adenosine present at the polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is utilized and the encoded protein extends for an additional seven amino acid residues. [provided by RefSeq, Mar 2012]'
• Protein Families: Druggable Genome, Secreted Protein