CLEC4D (NM_080387) Human Mass Spec Standard

CAT#: PH307032

CLEC4D MS Standard C13 and N15-labeled recombinant protein (NP_525126)

Product Images

Coomassie blue staining of purified CLEC4D protein (Cat# TP307032). The protein was produced from HEK293T cells transfected with CLEC4D cDNA clone (Cat# RC207032) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207032
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207032 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEK
  SELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLS
  YFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIP
  GTTLN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_525126
• RefSeq Size: 1973
• RefSeq ORF: 645
• Synonyms: CD368; CLEC-6; CLEC6; CLECSF8; Dectin-3; MCL; MPCL
• Locus ID: 338339
• UniProt ID: Q8WXI8
• Cytogenetics: 12p13.31
• Summary: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane