IMPDH1 (NM_183243) Human Mass Spec Standard
CAT#: PH307118
IMPDH1 MS Standard C13 and N15-labeled recombinant protein (NP_899066)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207118 |
Predicted MW | 60.4 kDa |
Protein Sequence |
>RC207118 protein sequence
Red=Cloning site Green=Tags(s) MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESMADYLISGGTGYVPEDGLTAQ QLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFI HHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSR DIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNR DYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIG GNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVG HVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQ GVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEK RLY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_899066 |
RefSeq Size | 2517 |
RefSeq ORF | 1689 |
Synonyms | IMPD; IMPD1; IMPDH-I; LCA11; RP10; sWSS2608 |
Locus ID | 3614 |
UniProt ID | P20839 |
Cytogenetics | 7q32.1 |
Summary | 'The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400315 | IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC405238 | IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420173 | IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC428185 | IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428186 | IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400315 | Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1 |
USD 495.00 |
|
LY405238 | Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 2 |
USD 325.00 |
|
LY420173 | Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 3 |
USD 495.00 |
|
LY428185 | Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 7 |
USD 325.00 |
|
LY428186 | Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 4 |
USD 325.00 |
|
PH315206 | IMPDH1 MS Standard C13 and N15-labeled recombinant protein (NP_000874) |
USD 2,055.00 |
|
TP307118 | Recombinant protein of human IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 2 |
USD 867.00 |
|
TP315206 | Recombinant protein of human IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review