RAB28 (NM_001017979) Human Mass Spec Standard

CAT#: PH307206

RAB28 MS Standard C13 and N15-labeled recombinant protein (NP_001017979)

Product Images

Coomassie blue staining of purified RAB28 protein (Cat# TP307206). The protein was produced from HEK293T cells transfected with RAB28 cDNA clone (Cat# RC207206) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207206
• Predicted MW: 24.8 kDa
• Protein Sequence:
  Sequence Link

  >RC207206 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIG
  GQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIK
  PEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTV
  NPPRSSMCAVQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001017979
• RefSeq Size: 1732
• RefSeq ORF: 663
• Synonyms: CORD18
• Locus ID: 9364
• UniProt ID: P51157
• Cytogenetics: 4p15.33
• Summary: This gene encodes a member of the Rab subfamily of Ras-related small GTPases. The encoded protein may be involved in regulating intracellular trafficking. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 9 and X. [provided by RefSeq, Apr 2009]
• Protein Families: Druggable Genome