MIF4GD (NM_020679) Human Mass Spec Standard

CAT#: PH307489

MIF4GD MS Standard C13 and N15-labeled recombinant protein (NP_065730)

Product Images

Coomassie blue staining of purified MIF4GD protein (Cat# TP307489). The protein was produced from HEK293T cells transfected with MIF4GD cDNA clone (Cat# RC207489) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207489
• Predicted MW: 29.4 kDa
• Protein Sequence:
  Sequence Link

  >RC207489 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEK
  VANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVT
  FICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVL
  IRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065730
• RefSeq Size: 1441
• RefSeq ORF: 768
• Synonyms: AD023; MIFD; SLIP1
• Locus ID: 57409
• UniProt ID: A9UHW6, A0A0S2Z5T5
• Cytogenetics: 17q25.1
• Summary: This gene encodes a protein which interacts with the N-terminus of the stem-loop binding protein (SLBP) and the 3' end of histone mRNA. This interaction facilitates the activation of histone mRNA translation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]