GNMT (NM_018960) Human Mass Spec Standard

CAT#: PH307497

GNMT MS Standard C13 and N15-labeled recombinant protein (NP_061833)

Product Images

Coomassie blue staining of purified GNMT protein (Cat# TP307497). The protein was produced from HEK293T cells transfected with GNMT cDNA clone (Cat# RC207497) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207497
• Predicted MW: 32.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207497 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGV
  DSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLG
  NSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVL
  IVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQ
  TYIPCYFIHVLKRTD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061833
• RefSeq Size: 1091
• RefSeq ORF: 885
• Synonyms: HEL-S-182mP
• Locus ID: 27232
• UniProt ID: Q14749, V9HW60
• Cytogenetics: 6p21.1
• Summary: The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644. [provided by RefSeq, Jan 2016]
• Protein Families: Druggable Genome
• Protein Pathways: Glycine, serine and threonine metabolism