ZFP200 (ZNF200) (NM_003454) Human Mass Spec Standard
CAT#: PH307594
ZNF200 MS Standard C13 and N15-labeled recombinant protein (NP_003445)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207594 |
Predicted MW | 45.5 kDa |
Protein Sequence |
>RC207594 protein sequence
Red=Cloning site Green=Tags(s) MMAAKVVPMPPKPKQSFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETL VIMKDVSSSLQNRVHPRPLVKLLPKGVQKEQETVSLYLKANPEELVVFEDLNVFHCQEECVSLDPTQQLT SEKEDDSSVGEMMLLAVNGSNPEGEDPEREPVENEDYREKSSDDDEMDSSLVSQQPPDNQEKERLNTSIP QKRKMRNLLVTIENDTPLEELSKYVDISIIALTRNRRTRRWYTCPLCGKQFNESSYLISHQRTHTGEKPY DCNHCGKSFNHKTNLNKHERIHTGEKPYSCSQCGKNFRQNSHRSRHEGIHIREKIFKCPECGKTFPKNEE FVLHLQSHEAERPYGCKKCGRRFGRLSNCTRHEKTHSACKTRKQK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003445 |
RefSeq Size | 3387 |
RefSeq ORF | 1185 |
Synonyms | MGC45293 |
Locus ID | 7752 |
UniProt ID | P98182, B3KP91 |
Cytogenetics | 16p13.3 |
Summary | Could have a role in spermatogenesis. [UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405074 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC405075 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418671 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428893 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428894 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428895 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430708 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405074 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 3 |
USD 396.00 |
|
LY405075 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 2 |
USD 396.00 |
|
LY418671 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 1 |
USD 396.00 |
|
LY428893 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 4 |
USD 396.00 |
|
LY428894 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 5 |
USD 396.00 |
|
LY428895 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 6 |
USD 396.00 |
|
LY430708 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 2 |
USD 396.00 |
|
TP307594 | Recombinant protein of human zinc finger protein 200 (ZNF200), transcript variant 1 |
USD 823.00 |
|
TP760180 | Recombinant protein of human zinc finger protein 200 (ZNF200), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
TP760732 | Purified recombinant protein of Human zinc finger protein 200 (ZNF200), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review