Somatostatin (SST) (NM_001048) Human Mass Spec Standard

CAT#: PH307601

SST MS Standard C13 and N15-labeled recombinant protein (NP_001039)

Product Images

Coomassie blue staining of purified SST protein (Cat# TP307601). The protein was produced from HEK293T cells transfected with SST cDNA clone (Cat# RC207601) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207601
• Predicted MW: 12.74 kDa
• Protein Sequence:
  Sequence Link

  >RC207601 representing NM_001048
  Red=Cloning site Green=Tags(s)
  
  MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEP
  EDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001039
• RefSeq Size: 665
• RefSeq ORF: 348
• Synonyms: SMST
• Locus ID: 6750
• UniProt ID: P61278
• Cytogenetics: 3q27.3
• Summary: 'The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein