AGXT2L2 (PHYKPL) (NM_153373) Human Mass Spec Standard

CAT#: PH307667

AGXT2L2 MS Standard C13 and N15-labeled recombinant protein (NP_699204)

Product Images

Coomassie blue staining of purified PHYKPL protein (Cat# TP307667). The protein was produced from HEK293T cells transfected with PHYKPL cDNA clone (Cat# RC207667) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207667
• Predicted MW: 49.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207667 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAADQRPKADTLALRQRLISSSCRLFFPEDPVKIVRAQGQYMYDEQGAEYIDCISNVAHVGHCHPLVVQA
  AHEQNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRLARHYTGHQDVVVLDHAY
  HGHLSSLIDISPYKFRNLDGQKEWVHVAPLPDTYRGPYREDHPNPAMAYANEVKRVVSSAQEKGRKIAAF
  FAESLPSVGGQIIPPAGYFSQVAEHIRKAGGVFVADEIQVGFGRVGKHFWAFQLQGKDFVPDIVTMGKSI
  GNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQ
  KIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLD
  NARQVVAKLDAILTDMEEKVRSCETLRLQP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_699204
• RefSeq Size: 2098
• RefSeq ORF: 1350
• Synonyms: AGXT2L2; PHLU
• Locus ID: 85007
• UniProt ID: Q8IUZ5
• Cytogenetics: 5q35.3
• Summary: This is a nuclear gene encoding a mitochondrial enzyme that catalyzes the conversion of 5-phosphonooxy-L-lysine to ammonia, inorganic phosphate, and 2-aminoadipate semialdehyde. Mutations in this gene may cause phosphohydroxylysinuria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
• Protein Families: Druggable Genome