NT5M (NM_020201) Human Mass Spec Standard

CAT#: PH307737

NT5M MS Standard C13 and N15-labeled recombinant protein (NP_064586)

Product Images

Coomassie blue staining of purified NT5M protein (Cat# TP307737). The protein was produced from HEK293T cells transfected with NT5M cDNA clone (Cat# RC207737) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207737
• Predicted MW: 25.9 kDa
• Protein Sequence:
  Sequence Link

  >RC207737 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALE
  DRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCP
  YEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRR
  LHSWADDWKAILDSKRPC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064586
• RefSeq Size: 1633
• RefSeq ORF: 684
• Synonyms: dNT-2; dNT2; mdN
• Locus ID: 56953
• UniProt ID: Q9NPB1
• Cytogenetics: 17p11.2
• Summary: This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]
• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism