BLCAP (NM_006698) Human Mass Spec Standard

CAT#: PH308259

BLCAP MS Standard C13 and N15-labeled recombinant protein (NP_006689)

Product Images

Coomassie blue staining of purified BLCAP protein (Cat# TP308259). The protein was produced from HEK293T cells transfected with BLCAP cDNA clone (Cat# RC208259) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208259
• Predicted MW: 9.7 kDa
• Protein Sequence:
  Sequence Link

  >RC208259 representing NM_006698
  Red=Cloning site Green=Tags(s)
  
  MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHC
  SDSPLPESAHDPGVVGT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006689
• RefSeq Size: 2057
• RefSeq ORF: 261
• Synonyms: BC10
• Locus ID: 10904
• UniProt ID: P62952
• Cytogenetics: 20q11.23
• Summary: This gene encodes a protein that reduces cell growth by stimulating apoptosis. Alternative splicing and the use of alternative promoters result in multiple transcript variants encoding the same protein. This gene is imprinted in brain where different transcript variants are expressed from each parental allele. Transcript variants initiating from the upstream promoter are expressed preferentially from the maternal allele, while transcript variants initiating downstream of the interspersed NNAT gene (GeneID:4826) are expressed from the paternal allele. Transcripts at this locus may also undergo A to I editing, resulting in amino acid changes at three positions in the N-terminus of the protein. [provided by RefSeq, Nov 2015]
• Protein Families: Transmembrane