HINT2 (NM_032593) Human Mass Spec Standard
CAT#: PH308371
HINT2 MS Standard C13 and N15-labeled recombinant protein (NP_115982)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208371 |
Predicted MW | 17.2 kDa |
Protein Sequence |
>RC208371 protein sequence
Red=Cloning site Green=Tags(s) MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILY EDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKL GAQSVYHLHIHVLGGRQLQWPPG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115982 |
RefSeq Size | 652 |
RefSeq ORF | 489 |
Synonyms | HIT-17 |
Locus ID | 84681 |
UniProt ID | Q9BX68 |
Cytogenetics | 9p13.3 |
Summary | Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]). [supplied by OMIM, Mar 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403175 | HINT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403175 | Transient overexpression lysate of histidine triad nucleotide binding protein 2 (HINT2), nuclear gene encoding mitochondrial protein |
USD 396.00 |
|
TP308371 | Recombinant protein of human histidine triad nucleotide binding protein 2 (HINT2) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review