ADSSL1 (NM_152328) Human Mass Spec Standard

CAT#: PH308536

ADSSL1 MS Standard C13 and N15-labeled recombinant protein (NP_689541)

Product Images

Coomassie blue staining of purified ADSSL1 protein (Cat# TP308536). The protein was produced from HEK293T cells transfected with ADSSL1 cDNA clone (Cat# RC208536) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208536
• Predicted MW: 50.2 kDa
• Protein Sequence:
  Sequence Link

  >RC208536 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGTRASNDRPPGAGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADIISRCQGGNNAG
  HTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKGLKDWEKRLIISDRAHLVFDF
  HQAVDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFSSRFKNLAHQHQSMFPTL
  EIDIEGQLKRLKGFAERIRPMVRDGVYFMYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGV
  CTGLGIPPQNIGDVYGVVKAYTTRVGIGAFPTEQINEIGGLLQTRGHEWGVTTGRKRRCGWLDLMILRYA
  HMVNGFTALALTKLDILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWE
  DLPPQAQNYIRFVENHVGVAVKWVGVGKSRESMIQLF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689541
• RefSeq Size: 1769
• RefSeq ORF: 1371
• Synonyms: Adss1; MPD5
• Locus ID: 122622
• UniProt ID: Q8N142
• Cytogenetics: 14q32.33
• Summary: This gene encodes a member of the adenylosuccinate synthase family of proteins. The encoded muscle-specific enzyme plays a role in the purine nucleotide cycle by catalyzing the first step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP). Mutations in this gene may cause adolescent onset distal myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Metabolic pathways, Purine metabolism