PHKG1 (NM_006213) Human Mass Spec Standard
CAT#: PH308591
PHKG1 MS Standard C13 and N15-labeled recombinant protein (NP_006204)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208591 |
Predicted MW | 45 kDa |
Protein Sequence |
>RC208591 protein sequence
Red=Cloning site Green=Tags(s) MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFSPEEVRELREA TLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRALLEVICT LHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGERLREVCGTPSYLAPEIIECSMNEDHPGYGKE VDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAE EALAHPFFQQYLVEEVRHFSPRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAY AFRIYGHWVKKGQQQNRAALFENTPKAVLLSLAEEDY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006204 |
RefSeq Size | 2130 |
RefSeq ORF | 1161 |
Synonyms | PHKG |
Locus ID | 5260 |
UniProt ID | Q16816, A0A024RDL4 |
Cytogenetics | 7p11.2 |
Summary | This gene is a member of the Ser/Thr protein kinase family and encodes a protein with one protein kinase domain and two calmodulin-binding domains. This protein is the catalytic member of a 16 subunit protein kinase complex which contains equimolar ratios of 4 subunit types. The complex is a crucial glycogenolytic regulatory enzyme. This gene has two pseudogenes at chromosome 7q11.21 and one at chromosome 11p11.12. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Calcium signaling pathway, Insulin signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401872 | PHKG1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401872 | Transient overexpression lysate of phosphorylase kinase, gamma 1 (muscle) (PHKG1) |
USD 396.00 |
|
TP308591 | Recombinant protein of human phosphorylase kinase, gamma 1 (muscle) (PHKG1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review