CA13 (NM_198584) Human Mass Spec Standard

CAT#: PH308607

CA13 MS Standard C13 and N15-labeled recombinant protein (NP_940986)

Product Images

Coomassie blue staining of purified CA13 protein (Cat# TP308607). The protein was produced from HEK293T cells transfected with CA13 cDNA clone (Cat# RC208607) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208607
• Predicted MW: 29.4 kDa
• Protein Sequence:
  Sequence Link

  >RC208607 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD
  FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD
  GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW
  IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_940986
• RefSeq Size: 3855
• RefSeq ORF: 786
• Synonyms: CAXIII
• Locus ID: 377677
• UniProt ID: Q8N1Q1
• Cytogenetics: 8q21.2
• Summary: Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800. [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Nitrogen metabolism