LRRC8A (NM_019594) Human Mass Spec Standard
CAT#: PH308632
LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_062540)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208632 |
Predicted MW | 94.2 kDa |
Protein Sequence |
>RC208632 protein sequence
Red=Cloning site Green=Tags(s) MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWVTKDSCNDSFR GWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAKYFPYLVLLHTLIFLACS NFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEESDPKPAFSKMNGSMDKKSSTVSEDVEATVP MLQRTKSRIEQGIVDRSETGVLDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIIC YTVYYVHNIKFDVDCTVDIESLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKK YSFESIREESSYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL TKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAF LRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQ VVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIE EIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFL PADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLP VELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_062540 |
RefSeq Size | 4368 |
RefSeq ORF | 2430 |
Synonyms | AGM5; LRRC8; SWELL1 |
Locus ID | 56262 |
UniProt ID | Q8IWT6, A0A024R892 |
Cytogenetics | 9q34.11 |
Summary | This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412721 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426737 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC426738 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY412721 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2 |
USD 396.00 |
|
LY426737 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1 |
USD 605.00 |
|
LY426738 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3 |
USD 605.00 |
|
PH326180 | LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120716) |
USD 2,055.00 |
|
PH326181 | LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120717) |
USD 2,055.00 |
|
TP308632 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2 |
USD 867.00 |
|
TP326180 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1 |
USD 748.00 |
|
TP326181 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review