ROR beta (RORB) (NM_006914) Human Mass Spec Standard

CAT#: PH308666

RORB MS Standard C13 and N15-labeled recombinant protein (NP_008845)

Product Images

Coomassie blue staining of purified RORB protein (Cat# TP308666). The protein was produced from HEK293T cells transfected with RORB cDNA clone (Cat# RC208666) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208666
• Predicted MW: 52.1 kDa
• Protein Sequence:
  Sequence Link

  >RC208666 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKC
  LALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYSSSISNGLSNLNNETSGT
  YANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMT
  EIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRI
  TGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLC
  SLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVC
  NLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008845
• RefSeq Size: 3604
• RefSeq ORF: 1377
• Synonyms: bA133M9.1; EIG15; NR1F2; ROR-BETA; RZR-BETA; RZRB
• Locus ID: 6096
• UniProt ID: Q58EY0
• Cytogenetics: 9q21.13
• Summary: 'The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, and to help regulate the expression of some genes involved in circadian rhythm. [provided by RefSeq, Feb 2014]'
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors