FRG1 (NM_004477) Human Mass Spec Standard

CAT#: PH308772

FRG1 MS Standard C13 and N15-labeled recombinant protein (NP_004468)

Product Images

Coomassie blue staining of purified FRG1 protein (Cat# TP308772). The protein was produced from HEK293T cells transfected with FRG1 cDNA clone (Cat# RC208772) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208772
• Predicted MW: 29.2 kDa
• Protein Sequence:
  Sequence Link

  >RC208772 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEYSYVKSTKLVLKGTKTKSKKKKSKDKKRKREEDEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYI
  HALDNGLFTLGAPHKEVDEGPSPPEQFTAVKLSDSRIALKSGYGKYLGINSDGLVVGRSDAIGPREQWEP
  VFQNGKMALLASNSCFIRCNEAGDIEAKSKTAGEEEMIKIRSCAERETKKKDDIPEEDKGNVKQCEINYV
  KKFQSFQDHKLKISKEDSKILKKARKDGFLHETLLDRRAKLKADRYCK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004468
• RefSeq Size: 1053
• RefSeq ORF: 774
• Synonyms: FRG1A; FSG1
• Locus ID: 2483
• UniProt ID: Q14331
• Cytogenetics: 4q35.2
• Summary: This gene maps to a location 100 kb centromeric of the repeat units on chromosome 4q35 which are deleted in facioscapulohumeral muscular dystrophy (FSHD). It is evolutionarily conserved and has related sequences on multiple human chromosomes but DNA sequence analysis did not reveal any homology to known genes. In vivo studies demonstrate the encoded protein is localized to the nucleolus. [provided by RefSeq, Jul 2008]