Carbonic Anhydrase IV (CA4) (NM_000717) Human Mass Spec Standard
CAT#: PH309229
CA4 MS Standard C13 and N15-labeled recombinant protein (NP_000708)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209229 |
Predicted MW | 35.03 kDa |
Protein Sequence |
>RC209229 representing NM_000717
Red=Cloning site Green=Tags(s) MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRF FFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMH IVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPK EEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRT VIKSGAPGRPLPWALPALLGPMLACLLAGFLR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000708 |
RefSeq Size | 1104 |
RefSeq ORF | 936 |
Synonyms | CAIV; Car4; RP17 |
Locus ID | 762 |
UniProt ID | P22748 |
Cytogenetics | 17q23.1 |
Summary | 'Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Its exact function is not known; however, it may have a role in inherited renal abnormalities of bicarbonate transport. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424546 | CA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424546 | Transient overexpression lysate of carbonic anhydrase IV (CA4) |
USD 325.00 |
|
TP309229 | Recombinant protein of human carbonic anhydrase IV (CA4) |
USD 823.00 |
|
TP720090 | Recombinant protein of human carbonic anhydrase IV (CA4) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review