HS3ST1 (NM_005114) Human Mass Spec Standard

CAT#: PH309256

HS3ST1 MS Standard C13 and N15-labeled recombinant protein (NP_005105)

Product Images

Coomassie blue staining of purified HS3ST1 protein (Cat# TP309256). The protein was produced from HEK293T cells transfected with HS3ST1 cDNA clone (Cat# RC209256) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209256
• Predicted MW: 35.8 kDa
• Protein Sequence:
  Sequence Link

  >RC209256 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALLLGAVLLVAQPQLVPSRTAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRAL
  LEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSI
  RLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLR
  HIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPK
  LLNKLHEYFHEPNKKFFELVGRTFDWH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005105
• RefSeq Size: 1965
• RefSeq ORF: 921
• Synonyms: 3OST; 3OST1
• Locus ID: 9957
• UniProt ID: O14792, A0A024R9R4
• Cytogenetics: 4p15.33
• Summary: Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Heparan sulfate biosynthesis