VWA1 (NM_022834) Human Mass Spec Standard

CAT#: PH309324

VWA1 MS Standard C13 and N15-labeled recombinant protein (NP_073745)

Product Images

Coomassie blue staining of purified VWA1 protein (Cat# TP309324). The protein was produced from HEK293T cells transfected with VWA1 cDNA clone (Cat# RC209324) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209324
• Predicted MW: 46.8 kDa
• Protein Sequence:
  Sequence Link

  >RC209324 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPWTALGLALSLRLALARSGAERGPPASAPRGDLMFLLDSSASVSHYEFSRVREFVGQLVAPLPLGTGA
  LRASLVHVGSRPYTEFPFGQHSSGEAAQDAVRASAQRMGDTHTGLALVYAKEQLFAEASGARPGVPKVLV
  WVTDGGSSDPVGPPMQELKDLGVTVFIVSTGRGNFLELSAAASAPAEKHLHFVDVDDLHIIVQELRGSIL
  DAMRPQQLHATEITSSGFRLAWPPLLTADSGYYVLELVPSAQPGAARRQQLPGNATDWIWAGLDPDTDYD
  VALVPESNVRLLRPQILRVRTRPGEAGPGASGPESGAGPAPTQLAALPAPEEAGPERIVISHARPRSLRV
  SWAPALGSAAALGYHVQFGPLRGGEAQRVEVPAGRNCTTLQGLAPGTAYLVTVTAAFRSGRESALSAKAC
  TPDGPRPRPRPVPRAPTPGTASREP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_073745
• RefSeq Size: 4659
• RefSeq ORF: 1335
• Synonyms: WARP
• Locus ID: 64856
• UniProt ID: Q6PCB0
• Cytogenetics: 1p36.33
• Summary: VWA1 belongs to the von Willebrand factor (VWF; MIM 613160) A (VWFA) domain superfamily of extracellular matrix proteins and appears to play a role in cartilage structure and function (Fitzgerald et al., 2002 [PubMed 12062410]). [supplied by OMIM, Nov 2010]