Cystatin S (CST4) (NM_001899) Human Mass Spec Standard
CAT#: PH309349
CST4 MS Standard C13 and N15-labeled recombinant protein (NP_001890)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209349 |
Predicted MW | 16.2 kDa |
Protein Sequence |
>RC209349 protein sequence
Red=Cloning site Green=Tags(s) MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATEDEYYRRPLQV LRAREQTFGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQE A myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001890 |
RefSeq Size | 736 |
RefSeq ORF | 423 |
Synonyms | MGC71923 |
Locus ID | 1472 |
UniProt ID | P01036 |
Cytogenetics | 20p11.21 |
Summary | 'The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a type 2 salivary cysteine peptidase inhibitor. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function. [provided by RefSeq, Jul 2008]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400707 | CST4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400707 | Transient overexpression lysate of cystatin S (CST4) |
USD 396.00 |
|
TP309349 | Recombinant protein of human cystatin S (CST4) |
USD 439.00 |
|
TP720293 | Recombinant protein of human cystatin S (CST4) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review