KK LC 1 (CT83) (NM_001017978) Human Mass Spec Standard
CAT#: PH309391
CXorf61 MS Standard C13 and N15-labeled recombinant protein (NP_001017978)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209391 |
Predicted MW | 12.8 kDa |
Protein Sequence |
>RC209391 protein sequence
Red=Cloning site Green=Tags(s) MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNF PHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001017978 |
RefSeq Size | 580 |
RefSeq ORF | 339 |
Synonyms | CXorf61; KK-LC-1; KKLC1 |
Locus ID | 203413 |
UniProt ID | Q5H943 |
Cytogenetics | Xq23 |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400409 | CT83 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400409 | Transient overexpression lysate of chromosome X open reading frame 61 (CXorf61) |
USD 396.00 |
|
TP309391 | Recombinant protein of human chromosome X open reading frame 61 (CXorf61) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review