Selenophosphate synthetase 1 (SEPHS1) (NM_012247) Human Mass Spec Standard

CAT#: PH309406

SEPHS1 MS Standard C13 and N15-labeled recombinant protein (NP_036379)

Product Images

Coomassie blue staining of purified SEPHS1 protein (Cat# TP309406). The protein was produced from HEK293T cells transfected with SEPHS1 cDNA clone (Cat# RC209406) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209406
• Predicted MW: 42.9 kDa
• Protein Sequence:
  Sequence Link

  >RC209406 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDT
  CVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKV
  MPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVA
  VHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAK
  QQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQ
  AWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036379
• RefSeq Size: 3275
• RefSeq ORF: 1176
• Synonyms: SELD; SPS; SPS1
• Locus ID: 22929
• UniProt ID: P49903
• Cytogenetics: 10p13
• Summary: This gene encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. [provided by RefSeq, Sep 2010]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Metabolic pathways, Selenoamino acid metabolism