TTDA (GTF2H5) (NM_207118) Human Mass Spec Standard

CAT#: PH309579

GTF2H5 MS Standard C13 and N15-labeled recombinant protein (NP_997001)

Product Images

Coomassie blue staining of purified GTF2H5 protein (Cat# TP309579). The protein was produced from HEK293T cells transfected with GTF2H5 cDNA clone (Cat# RC209579) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209579
• Predicted MW: 8.1 kDa
• Protein Sequence:
  Sequence Link

  >RC209579 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQ
  K
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_997001
• RefSeq Size: 7503
• RefSeq ORF: 213
• Synonyms: bA120J8.2; C6orf175; TFB5; TFIIH; TGF2H5; TTD; TTD-A; TTD3; TTDA
• Locus ID: 404672
• UniProt ID: Q6ZYL4
• Cytogenetics: 6q25.3
• Summary: This gene encodes a subunit of transcription/repair factor TFIIH, which functions in gene transcription and DNA repair. This protein stimulates ERCC3/XPB ATPase activity to trigger DNA opening during DNA repair, and is implicated in regulating cellular levels of TFIIH. Mutations in this gene result in trichothiodystrophy, complementation group A. [provided by RefSeq, Mar 2009]
• Protein Families: Transcription Factors
• Protein Pathways: Nucleotide excision repair