CIAPIN1 (NM_020313) Human Mass Spec Standard

CAT#: PH309626

CIAPIN1 MS Standard C13 and N15-labeled recombinant protein (NP_064709)

Product Images

Coomassie blue staining of purified CIAPIN1 protein (Cat# TP309626). The protein was produced from HEK293T cells transfected with CIAPIN1 cDNA clone (Cat# RC209626) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209626
• Predicted MW: 33.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209626 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPG
  STTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEV
  QSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSM
  DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLG
  DAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064709
• RefSeq Size: 2106
• RefSeq ORF: 936
• Synonyms: Anamorsin; CIAE2; DRE2; PRO0915
• Locus ID: 57019
• UniProt ID: Q6FI81
• Cytogenetics: 16q21
• Summary: CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]). [supplied by OMIM, Mar 2008]