MRPL52 (NM_178336) Human Mass Spec Standard

CAT#: PH309661

MRPL52 MS Standard C13 and N15-labeled recombinant protein (NP_848026)

Product Images

Coomassie blue staining of purified MRPL52 protein (Cat# TP309661). The protein was produced from HEK293T cells transfected with MRPL52 cDNA clone (Cat# RC209661) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209661
• Predicted MW: 13.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209661 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALGTVLFTGVRRLHCSAAAWAGGQWRLQQGLAANPSGYGPLTELPDCSYADGRPAPPMKGQLRRKAER
  ETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_848026
• RefSeq Size: 1123
• RefSeq ORF: 369
• Synonyms: mitochondrial ribosomal protein L52; OTTHUMP00000164489
• Locus ID: 122704
• UniProt ID: Q86TS9
• Cytogenetics: 14q11.2
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which has no bacterial homolog. Multiple transcript variants encoding different protein isoforms were identified through sequence analysis. [provided by RefSeq, Jul 2008]