Serine racemase (SRR) (NM_021947) Human Mass Spec Standard

CAT#: PH310359

SRR MS Standard C13 and N15-labeled recombinant protein (NP_068766)

Product Images

Coomassie blue staining of purified SRR protein (Cat# TP310359). The protein was produced from HEK293T cells transfected with SRR cDNA clone (Cat# RC210359) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210359
• Predicted MW: 36.6 kDa
• Protein Sequence:
  Sequence Link

  >RC210359 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPD
  ALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAK
  RVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAE
  PSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKL
  LIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068766
• RefSeq Size: 2477
• RefSeq ORF: 1020
• Synonyms: ILV1; ISO1
• Locus ID: 63826
• UniProt ID: Q9GZT4, Q3ZK31, Q8N3F4
• Cytogenetics: 17p13.3
• Summary: Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine. [UniProtKB/Swiss-Prot Function]
• Protein Pathways: Glycine, serine and threonine metabolism