NDUFA4 (NM_002489) Human Mass Spec Standard
CAT#: PH310482
NDUFA4 MS Standard C13 and N15-labeled recombinant protein (NP_002480)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210482 |
Predicted MW | 9.4 kDa |
Protein Sequence |
>RC210482 protein sequence
Red=Cloning site Green=Tags(s) MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVD YSKLKKERPDF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002480 |
RefSeq Size | 2058 |
RefSeq ORF | 243 |
Synonyms | CI-9k; CI-MLRQ; COXFA4; MLRQ |
Locus ID | 4697 |
UniProt ID | O00483, A0A024R9Z0 |
Cytogenetics | 7p21.3 |
Summary | 'The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq, Jul 2008]' |
Protein Families | Transmembrane |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400888 | NDUFA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400888 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa (NDUFA4), nuclear gene encoding mitochondrial protein |
USD 325.00 |
|
TP310482 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa (NDUFA4), nuclear gene encoding mitochondrial protein |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review