C4orf46 (NM_001008393) Human Mass Spec Standard
CAT#: PH310526
C4orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001008394)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210526 |
Predicted MW | 11.9 kDa |
Protein Sequence |
>RC210526 protein sequence
Red=Cloning site Green=Tags(s) MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKL LEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001008394 |
RefSeq Size | 3545 |
RefSeq ORF | 339 |
Synonyms | RCDG1 |
Locus ID | 201725 |
UniProt ID | Q504U0 |
Cytogenetics | 4q32.1 |
Summary | This gene encodes a small, conserved protein of unknown function that is expressed in a variety of tissues. There are pseudogenes for this gene on chromosomes 6, 8, 16, and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423420 | C4orf46 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY423420 | Transient overexpression lysate of chromosome 4 open reading frame 46 (C4orf46) |
USD 396.00 |
|
TP310526 | Recombinant protein of human chromosome 4 open reading frame 46 (C4orf46) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review