CMTM4 (NM_181521) Human Mass Spec Standard
CAT#: PH310793
CMTM4 MS Standard C13 and N15-labeled recombinant protein (NP_852662)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210793 |
Predicted MW | 22.7 kDa |
Protein Sequence |
>RC210793 representing NM_181521
Red=Cloning site Green=Tags(s) MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFI CIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVL AALNHRAGAEIAAVIFGFLETAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_852662 |
RefSeq Size | 8133 |
RefSeq ORF | 624 |
Synonyms | CKLFSF4 |
Locus ID | 146223 |
UniProt ID | Q8IZR5 |
Cytogenetics | 16q21-q22.1 |
Summary | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405676 | CMTM4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC405803 | CMTM4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405676 | Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 2 |
USD 396.00 |
|
LY405803 | Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 1 |
USD 396.00 |
|
TP310793 | Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review