CMTM4 (NM_181521) Human Mass Spec Standard

CAT#: PH310793

CMTM4 MS Standard C13 and N15-labeled recombinant protein (NP_852662)

Product Images

Coomassie blue staining of purified CMTM4 protein (Cat# TP310793). The protein was produced from HEK293T cells transfected with CMTM4 cDNA clone (Cat# RC210793) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210793
• Predicted MW: 22.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210793 representing NM_181521
  Red=Cloning site Green=Tags(s)
  
  MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFI
  CIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVL
  AALNHRAGAEIAAVIFGFLETAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_852662
• RefSeq Size: 8133
• RefSeq ORF: 624
• Synonyms: CKLFSF4
• Locus ID: 146223
• UniProt ID: Q8IZR5
• Cytogenetics: 16q21-q22.1
• Summary: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane