S100A5 (NM_002962) Human Mass Spec Standard
CAT#: PH310891
S100A5 MS Standard C13 and N15-labeled recombinant protein (NP_002953)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210891 |
Predicted MW | 12.8 kDa |
Protein Sequence |
>RC210891 protein sequence
Red=Cloning site Green=Tags(s) MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSI DDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002953 |
RefSeq Size | 710 |
RefSeq ORF | 333 |
Synonyms | S100D |
Locus ID | 6276 |
UniProt ID | P33763 |
Cytogenetics | 1q21.3 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418992 | S100A5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418992 | Transient overexpression lysate of S100 calcium binding protein A5 (S100A5) |
USD 396.00 |
|
TP310891 | Recombinant protein of human S100 calcium binding protein A5 (S100A5) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review