Apolipoprotein A V (APOA5) (NM_052968) Human Mass Spec Standard

CAT#: PH311023

APOA5 MS Standard C13 and N15-labeled recombinant protein (NP_443200)

Product Images

Coomassie blue staining of purified APOA5 protein (Cat# TP311023). The protein was produced from HEK293T cells transfected with APOA5 cDNA clone (Cat# RC211023) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211023
• Predicted MW: 41.2 kDa
• Protein Sequence:
  Sequence Link

  >RC211023 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSLEQDLNNMNKF
  LEKLRPLSGSEAPRLPQDPVGMRRQLQEELEEVKARLQPYMAEAHELVGWNLEGLRQQLKPYTMDLMEQV
  ALRVQELQEQLRVVGEDTKAQLLGGVDEAWALLQGLQSRVVHHTGRFKELFHPYAESLVSGIGRHVQELH
  RSVAPHAPASPARLSRCVQVLSRKLTLKAKALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEE
  VRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWED
  ITHSLHDQGHSHLGDP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443200
• RefSeq Size: 1954
• RefSeq ORF: 1098
• Synonyms: APOAV; RAP3
• Locus ID: 116519
• UniProt ID: Q6Q788, A0A0B4RUS7
• Cytogenetics: 11q23.3
• Summary: The protein encoded by this gene is an apolipoprotein that plays an important role in regulating the plasma triglyceride levels, a major risk factor for coronary artery disease. It is a component of high density lipoprotein and is highly similar to a rat protein that is upregulated in response to liver injury. Mutations in this gene have been associated with hypertriglyceridemia and hyperlipoproteinemia type 5. This gene is located proximal to the apolipoprotein gene cluster on chromosome 11q23. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Oct 2009]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: PPAR signaling pathway