HIST2H2BF (NM_001024599) Human Mass Spec Standard

CAT#: PH311042

HIST2H2BF MS Standard C13 and N15-labeled recombinant protein (NP_001019770)

Product Images

Coomassie blue staining of purified HIST2H2BF protein (Cat# TP311042). The protein was produced from HEK293T cells transfected with HIST2H2BF cDNA clone (Cat# RC211042) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211042
• Predicted MW: 13.9 kDa
• Protein Sequence:
  Sequence Link

  >RC211042 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI
  FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001019770
• RefSeq Size: 495
• RefSeq ORF: 378
• Synonyms: HIST2H2BF
• Locus ID: 440689
• UniProt ID: Q5QNW6
• Cytogenetics: 1q21.2
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-dependent histone that is a member of the histone H2B family and is found in a histone cluster on chromosome 1. [provided by RefSeq, Aug 2015]
• Protein Pathways: Systemic lupus erythematosus