PCPTP1 (PTPRR) (NM_130846) Human Mass Spec Standard
CAT#: PH311122
PTPRR MS Standard C13 and N15-labeled recombinant protein (NP_570897)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211122 |
Predicted MW | 46.6 kDa |
Protein Sequence |
>RC211122 protein sequence
Red=Cloning site Green=Tags(s) MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIRA TTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMEYLQSASRILTRSQLRD VVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGY SGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNEC DNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRT GCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_570897 |
RefSeq Size | 2782 |
RefSeq ORF | 1236 |
Synonyms | EC-PTP; PCPTP1; PTP-SL; PTPBR7; PTPRQ |
Locus ID | 5801 |
UniProt ID | Q15256, Q7Z2V8 |
Cytogenetics | 12q15 |
Summary | 'The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domain, and thus represents a receptor-type PTP. Silencing of this gene has been associated with colorectal cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares a symbol (PTPRQ) with another gene, protein tyrosine phosphatase, receptor type, Q (GeneID 374462), which is also located on chromosome 12. [provided by RefSeq, May 2011]' |
Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408898 | PTPRR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419077 | PTPRR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC429118 | PTPRR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408898 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 2 |
USD 396.00 |
|
LY419077 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 1 |
USD 605.00 |
|
LY429118 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 1 |
USD 396.00 |
|
PH312896 | PTPRR MS Standard C13 and N15-labeled recombinant protein (NP_002840) |
USD 2,055.00 |
|
TP311122 | Recombinant protein of human protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 2 |
USD 867.00 |
|
TP312896 | Recombinant protein of human protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review