TNFSF9 (NM_003811) Human Mass Spec Standard
CAT#: PH311160
TNFSF9 MS Standard C13 and N15-labeled recombinant protein (NP_003802)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211160 |
Predicted MW | 26.6 kDa |
Protein Sequence |
>RC211160 protein sequence
Red=Cloning site Green=Tags(s) MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRL REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGV YYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQ RLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003802 |
RefSeq Size | 1680 |
RefSeq ORF | 762 |
Synonyms | 4-1BB-L; CD137L; TNLG5A |
Locus ID | 8744 |
UniProt ID | P41273, A0A0U5J8I0 |
Cytogenetics | 19p13.3 |
Summary | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418412 | TNFSF9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418412 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9) |
USD 325.00 |
|
TP311160 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9) |
USD 823.00 |
|
TP700282 | Purified recombinant protein of human tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9), with C-terminal Fc tag, expressed in human cells, 20 µg |
USD 748.00 |
|
TP721145 | Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9) |
USD 330.00 |
|
TP723001 | Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review