CD153 (TNFSF8) (NM_001244) Human Mass Spec Standard
CAT#: PH311276
TNFSF8 MS Standard C13 and N15-labeled recombinant protein (NP_001235)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211276 |
Predicted MW | 26 kDa |
Protein Sequence |
>RC211276 protein sequence
Red=Cloning site Green=Tags(s) MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPN SPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYF IICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDT FQYIDTSTFPLENVLSIFLYSNSD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001235 |
RefSeq Size | 3797 |
RefSeq ORF | 702 |
Synonyms | CD30L; CD30LG; CD153; TNLG3A |
Locus ID | 944 |
UniProt ID | P32971, Q52M88 |
Cytogenetics | 9q32-q33.1 |
Summary | 'The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420051 | TNFSF8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY420051 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8) |
USD 396.00 |
|
TP311276 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8) |
USD 439.00 |
|
TP723393 | Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8). |
USD 140.00 |
{0} Product Review(s)
Be the first one to submit a review