Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Mass Spec Standard
CAT#: PH311299
CSNK2B MS Standard C13 and N15-labeled recombinant protein (NP_001311)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211299 |
Predicted MW | 24.9 kDa |
Protein Sequence |
>RC211299 protein sequence
Red=Cloning site Green=Tags(s) MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSD LIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKC MDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSP VKTIR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001311 |
RefSeq Size | 1149 |
RefSeq ORF | 645 |
Synonyms | CK2B; CK2N; Ckb1; Ckb2; CSK2B; G5A |
Locus ID | 1460 |
UniProt ID | P67870, N0E4C7 |
Cytogenetics | 6p21.33 |
Summary | 'This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]' |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Tight junction, Wnt signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400525 | CSNK2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400525 | Transient overexpression lysate of casein kinase 2, beta polypeptide (CSNK2B) |
USD 396.00 |
|
TP311299 | Recombinant protein of human casein kinase 2, beta polypeptide (CSNK2B) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review