5HT5A receptor (HTR5A) (NM_024012) Human Mass Spec Standard

CAT#: PH311300

HTR5A MS Standard C13 and N15-labeled recombinant protein (NP_076917)

Product Images

Coomassie blue staining of purified HTR5A protein (Cat# TP311300). The protein was produced from HEK293T cells transfected with HTR5A cDNA clone (Cat# RC211300) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211300
• Predicted MW: 40.3 kDa
• Protein Sequence:
  Sequence Link

  >RC211300 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRT
  FHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRY
  WSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFY
  LPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKE
  QRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFK
  NFFSRQH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076917
• RefSeq Size: 4572
• RefSeq ORF: 1071
• Synonyms: 5-HT5A
• Locus ID: 3361
• UniProt ID: P47898, A4D2N2
• Cytogenetics: 7q36.2
• Summary: 'The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Calcium signaling pathway, Neuroactive ligand-receptor interaction