KCNRG (NM_199464) Human Mass Spec Standard

CAT#: PH312086

KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_955751)

Product Images

Coomassie blue staining of purified KCNRG protein (Cat# TP312086). The protein was produced from HEK293T cells transfected with KCNRG cDNA clone (Cat# RC212086) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212086
• Predicted MW: 25.7 kDa
• Protein Sequence:
  Sequence Link

  >RC212086 representing NM_199464
  Red=Cloning site Green=Tags(s)
  
  MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTHQL
  LLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFFRVFGSCSKTIEMLTGRI
  TVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQCGSDSTTDNQTGVRLVCNGVISAHHNLRLWG
  SSDSPASASRVAGITGMFL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_955751
• RefSeq Size: 1625
• RefSeq ORF: 687
• Synonyms: DLTET
• Locus ID: 283518
• UniProt ID: Q8N5I3
• Cytogenetics: 13q14.2
• Summary: This gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]