RED1 (ADARB1) (NM_015833) Human Mass Spec Standard
CAT#: PH312324
ADARB1 MS Standard C13 and N15-labeled recombinant protein (NP_056648)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212324 |
Predicted MW | 80.6 kDa |
Protein Sequence |
>RC212324 representing NM_015833
Red=Cloning site Green=Tags(s) MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSNGHSKYRLKKR RKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALR SFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSA SPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRN KKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRK VLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDD QKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEGSRSYTQAGVQWCNHGSLQPRPPGL LSDPSTSTFQGAGTTEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKI ARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEAR QPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHE SKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056648 |
RefSeq Size | 5035 |
RefSeq ORF | 2223 |
Synonyms | ADAR2; DRABA2; DRADA2; RED1 |
Locus ID | 104 |
UniProt ID | P78563 |
Cytogenetics | 21q22.3 |
Summary | 'This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414364 | ADARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420129 | ADARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431557 | ADARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY414364 | Transient overexpression lysate of adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 2 |
USD 605.00 |
|
LY420129 | Transient overexpression lysate of adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 1 |
USD 396.00 |
|
LY431557 | Transient overexpression lysate of adenosine deaminase, RNA-specific, B1 (ADARB1), transcript variant 7 |
USD 605.00 |
|
PH309073 | ADARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001103) |
USD 2,055.00 |
|
TP309073 | Recombinant protein of human adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 1 |
USD 788.00 |
|
TP312324 | Purified recombinant protein of Homo sapiens adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review