TAS1R1 (NM_177540) Human Mass Spec Standard
CAT#: PH312370
TAS1R1 MS Standard C13 and N15-labeled recombinant protein (NP_803884)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212370 |
Predicted MW | 65 kDa |
Protein Sequence |
>RC212370 representing NM_177540
Red=Cloning site Green=Tags(s) MLLCTARLVGLQLLISCCWAFACHSTESSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVTLCDRSCSFNE HGYHLFQAMRLGVEEINNSTALLPNITLGYQLYDVCSDSANVYATLRVLSLPGQHHIELQGDLLHYSPTV LAVIGPDSTNRAATTAALLSPFLVPMLLEQIHKVHFLLHKDTVAFNDNRDPLSSYNIIAWDWNGPKWTFT VLGSSTWSPVQLNINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLY RCQPCGKEEWAPEGSQTCFPRTVVFLALREHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSAGGRL CFLMLGSLAAGSGSLYGFFGEPTRPACLLRQALFALGFTIFLSCLTVRSFQLIIIFKFSTKVPTFYHAWV QNHGAGLFVMISSAAQLLICLTWLVVWTPLPAREYQRFPHLVMLECTETNSLGFILAFLYNGLLSISAFA CSYLGKDLPENYNEAKCVTFSLLFNFVSWIAFFTTASVYDGKYLPAANMMAGLSSLSSGFGGYFLPKCYV ILCRPDLNSTEHFQASIQDYTRRCGST myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_803884 |
RefSeq Size | 1945 |
RefSeq ORF | 1761 |
Synonyms | GM148; GPR70; T1R1; TR1 |
Locus ID | 80835 |
UniProt ID | Q7RTX1, A8K7J9 |
Cytogenetics | 1p36.31 |
Summary | The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Taste transduction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403591 | TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC406077 | TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC408549 | TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY403591 | Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 3 |
USD 495.00 |
|
LY406077 | Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 4 |
USD 325.00 |
|
LY408549 | Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 2 |
USD 495.00 |
|
TP312370 | Recombinant protein of human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3 |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review