AMMECR1 (NM_015365) Human Mass Spec Standard

CAT#: PH312378

AMMECR1 MS Standard C13 and N15-labeled recombinant protein (NP_056180)

Product Images

Coomassie blue staining of purified AMMECR1 protein (Cat# TP312378). The protein was produced from HEK293T cells transfected with AMMECR1 cDNA clone (Cat# RC212378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212378
• Predicted MW: 35.3 kDa
• Protein Sequence:
  Sequence Link

  >RC212378 representing NM_015365
  Red=Cloning site Green=Tags(s)
  
  MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTL
  SPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYC
  HLYGYQQPRTPRFTNEPYPLFVTWKIGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFPPMTRDEL
  PRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGY
  KAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056180
• RefSeq Size: 5431
• RefSeq ORF: 999
• Synonyms: AMMERC1; MFHIEN
• Locus ID: 9949
• UniProt ID: Q9Y4X0, A0A0S2Z4X0
• Cytogenetics: Xq23
• Summary: The exact function of this gene is not known, however, submicroscopic deletion of the X chromosome including this gene, COL4A5, and FACL4 genes, result in a contiguous gene deletion syndrome, the AMME complex (Alport syndrome, mental retardation, midface hypoplasia, and elliptocytosis). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]
• Protein Families: Druggable Genome