Parvalbumin (PVALB) (NM_002854) Human Mass Spec Standard

CAT#: PH312427

PVALB MS Standard C13 and N15-labeled recombinant protein (NP_002845)

Product Images

Coomassie blue staining of purified PVALB protein (Cat# TP312427). The protein was produced from HEK293T cells transfected with PVALB cDNA clone (Cat# RC212427) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212427
• Predicted MW: 12.1 kDa
• Protein Sequence:
  Sequence Link

  >RC212427 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKG
  FSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002845
• RefSeq Size: 586
• RefSeq ORF: 330
• Synonyms: D22S749
• Locus ID: 5816
• UniProt ID: P20472, A0A024R1K9
• Cytogenetics: 22q12.3
• Summary: 'The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]'