TAF13 (NM_005645) Human Mass Spec Standard

CAT#: PH312721

TAF13 MS Standard C13 and N15-labeled recombinant protein (NP_005636)

Product Images

Coomassie blue staining of purified TAF13 protein (Cat# TP312721). The protein was produced from HEK293T cells transfected with TAF13 cDNA clone (Cat# RC212721) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212721
• Predicted MW: 14.3 kDa
• Protein Sequence:
  Sequence Link

  >RC212721 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTH
  KAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005636
• RefSeq Size: 577
• RefSeq ORF: 372
• Synonyms: MRT60; TAF(II)18; TAF2K; TAFII-18; TAFII18
• Locus ID: 6884
• UniProt ID: Q15543, A0A024R089
• Cytogenetics: 1p13.3
• Summary: 'Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors