DEGS1 (NM_003676) Human Mass Spec Standard

CAT#: PH312803

DEGS1 MS Standard C13 and N15-labeled recombinant protein (NP_003667)

Product Images

Coomassie blue staining of purified DEGS1 protein (Cat# TP312803). The protein was produced from HEK293T cells transfected with DEGS1 cDNA clone (Cat# RC212803) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212803
• Predicted MW: 37.9 kDa
• Protein Sequence:
  Sequence Link

  >RC212803 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVI
  FGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGV
  DVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLV
  YMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIA
  AEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003667
• RefSeq Size: 2101
• RefSeq ORF: 969
• Synonyms: DEGS; DEGS-1; Des-1; DES1; FADS7; HLD18; MIG15; MLD
• Locus ID: 8560
• UniProt ID: O15121, A0A024R3P1
• Cytogenetics: 1q42.11
• Summary: This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. [provided by RefSeq, Mar 2010]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, Sphingolipid metabolism