PTPN20B (PTPN20) (NM_001042363) Human Mass Spec Standard

CAT#: PH312878

PTPN20B MS Standard C13 and N15-labeled recombinant protein (NP_001035822)

Product Images

Coomassie blue staining of purified PTPN20 protein (Cat# TP312878). The protein was produced from HEK293T cells transfected with PTPN20 cDNA clone (Cat# RC212878) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212878
• Predicted MW: 39 kDa
• Protein Sequence:
  Sequence Link

  >RC212878 representing NM_001042363
  Red=Cloning site Green=Tags(s)
  
  MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILE
  EKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGE
  EYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQI
  LQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTG
  VFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035822
• RefSeq Size: 2872
• RefSeq ORF: 1017
• Synonyms: bA42B19.1; bA142I17.1; CT126; PTPN20A; PTPN20B
• Locus ID: 26095
• UniProt ID: Q4JDL3, Q9Y406
• Cytogenetics: 10q11.22
• Summary: The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites of actin polymerization. A pseudogene of this gene has been defined on chromosome 10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
• Protein Families: Druggable Genome, Phosphatase