CTNNBIP1 (NM_001012329) Human Mass Spec Standard

CAT#: PH312922

CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001012329)

Product Images

Coomassie blue staining of purified CTNNBIP1 protein (Cat# TP312922). The protein was produced from HEK293T cells transfected with CTNNBIP1 cDNA clone (Cat# RC212922) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212922
• Predicted MW: 9 kDa
• Protein Sequence:
  Sequence Link

  >RC212922 representing NM_001012329
  Red=Cloning site Green=Tags(s)
  
  MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA
  FSRSETEDRRQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001012329
• RefSeq Size: 2961
• RefSeq ORF: 243
• Synonyms: ICAT
• Locus ID: 56998
• UniProt ID: Q9NSA3, A0A024R4D7
• Cytogenetics: 1p36.22
• Summary: The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Wnt signaling pathway