ACVRL1 (NM_001077401) Human Mass Spec Standard

CAT#: PH313389

ACVRL1 MS Standard C13 and N15-labeled recombinant protein (NP_001070869)

Product Images

Coomassie blue staining of purified ACVRL1 protein (Cat# TP313389). The protein was produced from HEK293T cells transfected with ACVRL1 cDNA clone (Cat# RC213389) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213389
• Predicted MW: 56.1 kDa
• Protein Sequence:
  Sequence Link

  >RC213389 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCG
  NLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLALILGPVLALLALVALGVLGL
  WHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGK
  GRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYH
  EHGSLYDFLQRQTLEPHLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLG
  LAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED
  YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQ
  KISNSPEKPKVIQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001070869
• RefSeq Size: 4126
• RefSeq ORF: 1509
• Synonyms: ACVRLK1; ALK-1; ALK1; HHT; HHT2; ORW2; SKR3; TSR-I
• Locus ID: 94
• UniProt ID: P37023, A0A0S2Z310
• Cytogenetics: 12q13.13
• Summary: 'This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Protein Kinase, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, TGF-beta signaling pathway