ACVRL1 (NM_001077401) Human Mass Spec Standard
CAT#: PH313389
ACVRL1 MS Standard C13 and N15-labeled recombinant protein (NP_001070869)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213389 |
Predicted MW | 56.1 kDa |
Protein Sequence |
>RC213389 protein sequence
Red=Cloning site Green=Tags(s) MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCG NLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLALILGPVLALLALVALGVLGL WHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGK GRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYH EHGSLYDFLQRQTLEPHLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLG LAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQ KISNSPEKPKVIQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001070869 |
RefSeq Size | 4126 |
RefSeq ORF | 1509 |
Synonyms | ACVRLK1; ALK-1; ALK1; HHT; HHT2; ORW2; SKR3; TSR-I |
Locus ID | 94 |
UniProt ID | P37023, A0A0S2Z310 |
Cytogenetics | 12q13.13 |
Summary | 'This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421410 | ACVRL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY421410 | Transient overexpression lysate of activin A receptor type II-like 1 (ACVRL1), transcript variant 2 |
USD 605.00 |
|
TP313389 | Recombinant protein of human activin A receptor type II-like 1 (ACVRL1), transcript variant 2 |
USD 867.00 |
|
TP761932 | Purified recombinant protein of Human activin A receptor type II-like 1 (ACVRL1), transcript variant 1,Asp22-Leu119, with N-terminal His-ABP tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review