BCS1L (NM_001079866) Human Mass Spec Standard
CAT#: PH313712
BCS1L MS Standard C13 and N15-labeled recombinant protein (NP_001073335)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213712 |
Predicted MW | 47.5 kDa |
Protein Sequence |
>RC213712 protein sequence
Red=Cloning site Green=Tags(s) MPLSDFILALKDNPYFGAGFGLVGVGTALALARKGVQLGLVAFRRHYMITLEVPARDRSYAWLLSWLTRH STRTQHLSVETSYLQHESGRISTKFEFVPSPGNHFIWYRGKWIRVERSREMQMIDLQTGTPWESVTFTAL GTDRKVFFNILEEARELALQQEEGKTVMYTAVGSEWRPFGYPRRRRPLNSVVLQQGLADRIVRDVQEFID NPKWYTDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVL LEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNHVDRLDPALIRPGRVDLK EYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLRR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001073335 |
RefSeq Size | 1454 |
RefSeq ORF | 1257 |
Synonyms | BCS; BCS1; BJS; FLNMS; GRACILE; h-BCS; h-BCS1; Hs.6719; MC3DN1; PTD |
Locus ID | 617 |
UniProt ID | Q9Y276, A0A024R445 |
Cytogenetics | 2q35 |
Summary | 'This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Several alternatively spliced transcripts encoding two different isoforms have been described. [provided by RefSeq, Jan 2016]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418060 | BCS1L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421566 | BCS1L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425902 | BCS1L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418060 | Transient overexpression lysate of BCS1-like (yeast) (BCS1L), transcript variant 1 |
USD 396.00 |
|
LY421566 | Transient overexpression lysate of BCS1-like (yeast) (BCS1L), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 605.00 |
|
LY425902 | Transient overexpression lysate of BCS1-like (yeast) (BCS1L), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 396.00 |
|
PH301195 | BCS1L MS Standard C13 and N15-labeled recombinant protein (NP_004319) |
USD 2,055.00 |
|
TP301195 | Recombinant protein of human BCS1-like (yeast) (BCS1L), transcript variant 1 |
USD 867.00 |
|
TP313712 | Recombinant protein of human BCS1-like (yeast) (BCS1L), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review